PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100103630021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 253aa    MW: 27975.9 Da    PI: 4.4555
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100103630021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof919.8e-293694661
                        zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGa...lrnvPvGggrrknkks 61
                                   +cprC s+ntkfCyynnys sqPryfCkaCrryWtk         vPvGgg+rk+++s
  Ote100103630021|100103630021 36 PNCPRCASSNTKFCYYNNYSFSQPRYFCKACRRYWTKXXXxxxXXXVPVGGGCRKSRRS 94
                                  58**********************************9865111578**********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-202293IPR003851Zinc finger, Dof-type
PfamPF027014.0E-243693IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.2353693IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MMFSCTTTTV DPYSNSMPIA PLLTTKWKYN NIEIAPNCPR CASSNTKFCY YNNYSFSQPR  60
YFCKACRRYW TKXXXXXXXX XVPVGGGCRK SRRSRAANRQ ADGPNYANTV AAVGATVSTK  120
GSDNGACIDM ADVFAKYVNQ KVDSEESAST GSSSDNGQQS CRLEEINTIV EGEKPLDDLI  180
GDPTMDHLST FHDVSSQQFV YQDCDGFELQ QGVLCDEEIL WSEGTTPVVE QALVQVEDCG  240
LLVPDNDQLR ISA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069612.11e-59PREDICTED: dof zinc finger protein DOF1.2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419